PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00996.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 297aa    MW: 32724.9 Da    PI: 9.7127
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00996.1_g00003.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding21.94.1e-07757348
                             SS-HHHHHHHHHHHHHTTTT......-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  3 rWTteEdellvdavkqlGgg......tWktIartmgkgRtlkqcksrwqkyl 48
                              W+ eE++ + + ++++  +      +W + a++++ +++l ++k ++q +l
  Rsa1.0_00996.1_g00003.1  7 TWSREEEKSFENSIALHCVKeeitedQWMKMASMVP-TKSLQEVKKHYQVLL 57
                             6****************999****************.************986 PP

2Myb_DNA-binding41.53.1e-13129173347
                              SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              +WT+eE+ l++ + +++G+g+W++I+r    +Rt+ q+ s+ qky
  Rsa1.0_00996.1_g00003.1 129 PWTQEEHRLFLLGLEKFGKGDWRSISRNYVITRTPTQVASHAQKY 173
                              7*****************************89************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512936.858361IPR017884SANT domain
SMARTSM007170.0055459IPR001005SANT/Myb domain
CDDcd001672.54E-5757No hitNo description
SuperFamilySSF466891.24E-7864IPR009057Homeodomain-like
PROSITE profilePS5129417.259122178IPR017930Myb domain
SuperFamilySSF466892.84E-17123179IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-17125176IPR006447Myb domain, plants
SMARTSM007176.6E-11126176IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-10127172IPR009057Homeodomain-like
CDDcd001671.97E-10129174No hitNo description
PfamPF002491.0E-11129173IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MESVAVTWSR EEEKSFENSI ALHCVKEEIT EDQWMKMASM VPTKSLQEVK KHYQVLLEDV  60
KAIESGQVPL PRYQRTGEEA AATSPANRDC HSSGGGGSTE KKPNHGISSS NGGGRSSSRQ  120
EQERKKGIPW TQEEHRLFLL GLEKFGKGDW RSISRNYVIT RTPTQVASHA QKYFIRLNSM  180
NRDRRRSSIH DITSVNNQAA AVTGQQQQQV VKHRPAQPQA QPQPQHHTMA GLGMYGGAPV  240
GQPIIAPPDH MGSAVGTPVM LPPPMGTHHH LGVAPYAVPS YPVPPLPQQH PAPSTMH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A4e-148771177RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0869061e-136AY086906.1 Arabidopsis thaliana clone 29302 mRNA, complete sequence.
GenBankAY5195281e-136AY519528.1 Arabidopsis thaliana MYB transcription factor (At1g49010) mRNA, complete cds.
GenBankBT0248621e-136BT024862.1 Arabidopsis thaliana At1g49010 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013641722.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_013676680.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_013731110.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H72e-56DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A078JEL90.0A0A078JEL9_BRANA; BnaA08g29670D protein
STRINGBra014169.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM103042535
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49010.11e-119MYB family protein